PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa002606
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family HD-ZIP
Protein Properties Length: 254aa    MW: 28773.7 Da    PI: 8.5891
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58674995PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.41.2e-18125179256
                T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                rk+ ++t+eq+ +Lee F++++++++++++ LA++l L+ rqV vWFqNrRa+ k
  Lsa002606 125 RKKLRLTNEQTLVLEESFKQHNTLNRKQKQALATSLVLQPRQVEVWFQNRRARTK 179
                788899***********************************************98 PP

2HD-ZIP_I/II1154.6e-37125213190
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                  +kk+rl++eq  +LEesF+++++L+ ++K++la++L lqprqv+vWFqnrRARtk+kq E+d++ Lk++++a+k++n+rLeke +eL+ +
    Lsa002606 125 RKKLRLTNEQTLVLEESFKQHNTLNRKQKQALATSLVLQPRQVEVWFQNRRARTKLKQNEVDCTLLKKCCEAIKSDNKRLEKEIQELK-A 213
                  69*************************************************************************************9.4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.6E-18115182IPR009057Homeodomain-like
SuperFamilySSF466891.11E-17118182IPR009057Homeodomain-like
PROSITE profilePS5007117.184121181IPR001356Homeobox domain
SMARTSM003894.2E-15123185IPR001356Homeobox domain
PfamPF000466.3E-16125179IPR001356Homeobox domain
CDDcd000868.15E-15125182No hitNo description
PROSITE patternPS000270156179IPR017970Homeobox, conserved site
PfamPF021835.7E-8181213IPR003106Leucine zipper, homeobox-associated
SMARTSM003402.5E-13181224IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MDHEVSCVTS LNLSLAGDHG FPTNHLIYLH AEEQEQEQLE RKSILKWDPC VPSLKLGLGR  60
DQESHPDPIN WIPQASNSTV NTISSFSKST SIKRERDGGS QEVEKVLSKA VIEIDQDESE  120
GRGARKKLRL TNEQTLVLEE SFKQHNTLNR KQKQALATSL VLQPRQVEVW FQNRRARTKL  180
KQNEVDCTLL KKCCEAIKSD NKRLEKEIQE LKAIRTTISM PPQFNIQFPA ASHSMCLSCE  240
RIVSRCVSGG GGRR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1173181RRARTKLKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010939328.12e-58PREDICTED: homeobox-leucine zipper protein HAT9-like
SwissprotP466032e-49HAT9_ARATH; Homeobox-leucine zipper protein HAT9
TrEMBLA0A103YCY43e-97A0A103YCY4_CYNCS; Homeobox, conserved site-containing protein (Fragment)
STRINGVIT_00s0732g00010.t011e-56(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.11e-48HD-ZIP family protein